CLIC4 antibody (70R-1498)

Rabbit polyclonal CLIC4 antibody raised against the N terminal of CLIC4

Synonyms Polyclonal CLIC4 antibody, Anti-CLIC4 antibody, CLIC 4 antibody, CLIC 4, CLIC-4 antibody, Chloride Intracellular Channel 4 antibody, CLIC4, CLIC-4
Specificity CLIC4 antibody was raised against the N terminal of CLIC4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
Assay Information CLIC4 Blocking Peptide, catalog no. 33R-5440, is also available for use as a blocking control in assays to test for specificity of this CLIC4 antibody


Western Blot analysis using CLIC4 antibody (70R-1498)

CLIC4 antibody (70R-1498) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLIC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIon Channel4) protein, encoded by the CLIon Channel4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CLIC4 antibody (70R-1498) | CLIC4 antibody (70R-1498) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors