CMAS antibody (70R-2032)

Rabbit polyclonal CMAS antibody raised against the N terminal of CMAS

Synonyms Polyclonal CMAS antibody, Anti-CMAS antibody, Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase antibody
Specificity CMAS antibody was raised against the N terminal of CMAS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CMAS antibody was raised using the N terminal of CMAS corresponding to a region with amino acids GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF
Assay Information CMAS Blocking Peptide, catalog no. 33R-3531, is also available for use as a blocking control in assays to test for specificity of this CMAS antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CMAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CMAS is an enzyme that catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors