Coactosin-Like 1 antibody (70R-2639)

Rabbit polyclonal Coactosin-Like 1 antibody

Synonyms Polyclonal Coactosin-Like 1 antibody, Anti-Coactosin-Like 1 antibody, Dictyostelium antibody, MGC19733 antibody, COTL1 antibody, FLJ43657 antibody, CLP antibody
Cross Reactivity Human, Mouse
Applications WB
Immunogen Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ
Assay Information Coactosin-Like 1 Blocking Peptide, catalog no. 33R-5779, is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody


Western Blot analysis using Coactosin-Like 1 antibody (70R-2639)

Coactosin-Like 1 antibody (70R-2639) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COTL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Coactosin-Like 1 antibody (70R-2639) | Coactosin-Like 1 antibody (70R-2639) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors