COL8A2 Blocking Peptide (33R-1023)
A synthetic peptide for use as a blocking control in assays to test for specificity of COL8A2 antibody, catalog no. 70R-9966
Overview
Overview
| Synonyms | COL8A2 control peptide, COL8A2 antibody Blocking Peptide, Anti-COL8A2 Blocking Peptide, collagen, type VIII, alpha 2 Blocking Peptide, FECD Blocking Peptide, FECD1 Blocking Peptide, FLJ00201 Blocking Peptide, MGC116970 Blocking Peptide, MGC116972 Blocking Peptide, PPCD Blocking Peptide, PPCD2 Blocking Peptide, COL8A2, COLA2-8, COLA2 8, COLA2-8 Blocking Peptide, COLA2 8 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG |
|---|---|
| Molecular Weight | 67 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | COL8A2 is the alpha 2 chain of type VIII collagen. The protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this COL8A2 gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2 |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product