COL8A2 Blocking Peptide (33R-1023)

A synthetic peptide for use as a blocking control in assays to test for specificity of COL8A2 antibody, catalog no. 70R-9966

Synonyms COL8A2 control peptide, COL8A2 antibody Blocking Peptide, Anti-COL8A2 Blocking Peptide, collagen, type VIII, alpha 2 Blocking Peptide, FECD Blocking Peptide, FECD1 Blocking Peptide, FLJ00201 Blocking Peptide, MGC116970 Blocking Peptide, MGC116972 Blocking Peptide, PPCD Blocking Peptide, PPCD2 Blocking Peptide, COL8A2, COLA2-8, COLA2 8, COLA2-8 Blocking Peptide, COLA2 8 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG
Molecular Weight 67 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance COL8A2 is the alpha 2 chain of type VIII collagen. The protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this COL8A2 gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors