Complement C4b antibody (70R-5742)

Rabbit polyclonal Complement C4b antibody

Synonyms Polyclonal Complement C4b antibody, Anti-Complement C4b antibody, C4B5 antibody, Complement Cb-4, Complement Cb-4 antibody, Complement Cb 4 antibody, MGC164979 antibody, Complement Cb 4, CH antibody, C4B1 antibody, C4B antibody, C4B3 antibody, C4B12 antibody, C4F antibody, CPAMD3 antibody, C4A91 antibody, Complement C4b, CO4 antibody, C4A13 antibody, C4B2 antibody, C4A antibody
Cross Reactivity Human
Applications WB
Immunogen Complement C4b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
Assay Information Complement C4b Blocking Peptide, catalog no. 33R-7746, is also available for use as a blocking control in assays to test for specificity of this Complement C4b antibody

Images

Western Blot analysis using Complement C4b antibody (70R-5742)

Complement C4b antibody (70R-5742) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Complement C4b antibody (70R-5742) | Complement C4b antibody (70R-5742) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors