Copine I antibody (70R-1407)

Rabbit polyclonal Copine I antibody raised against the N terminal of CPNE1

Synonyms Polyclonal Copine I antibody, Anti-Copine I antibody, CPN1 antibody, Copine 1 antibody, MGC1142 antibody, COPN1 antibody, CPNE1 antibody
Specificity Copine I antibody was raised against the N terminal of CPNE1
Cross Reactivity Human
Applications IHC, WB
Immunogen Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG
Assay Information Copine I Blocking Peptide, catalog no. 33R-9369, is also available for use as a blocking control in assays to test for specificity of this Copine I antibody


Immunohistochemical staining using Copine I antibody (70R-1407)

Copine I antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine . Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CPNE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Copine I antibody (70R-1407) | Copine I antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine . Magnification is at 400X
  • Western Blot analysis using Copine I antibody (70R-1407) | Copine I antibody (70R-1407) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors