Copine IX antibody (70R-4191)

Rabbit polyclonal Copine IX antibody raised against the middle region of CPNE9

Synonyms Polyclonal Copine IX antibody, Anti-Copine IX antibody, Copine 9 antibody, COPN9 antibody, CPN9 antibody, Copine Family Member Ix antibody, KIAA4217 antibody
Specificity Copine IX antibody was raised against the middle region of CPNE9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Copine IX antibody was raised using the middle region of CPNE9 corresponding to a region with amino acids YDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKC
Assay Information Copine IX Blocking Peptide, catalog no. 33R-10075, is also available for use as a blocking control in assays to test for specificity of this Copine IX antibody


Western Blot analysis using Copine IX antibody (70R-4191)

Copine IX antibody (70R-4191) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPNE9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CPNE9 may function in membrane trafficking. It exhibits calcium-dependent phospholipid binding properties.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Copine IX antibody (70R-4191) | Copine IX antibody (70R-4191) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors