COPS4 antibody (70R-3609)

Rabbit polyclonal COPS4 antibody

Synonyms Polyclonal COPS4 antibody, Anti-COPS4 antibody, Arabidopsis antibody, MGC15160 antibody, MGC10899 antibody, Cop9 Constitutive Photomorphogenic Homolog Subunit 4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA
Assay Information COPS4 Blocking Peptide, catalog no. 33R-10150, is also available for use as a blocking control in assays to test for specificity of this COPS4 antibody


Western Blot analysis using COPS4 antibody (70R-3609)

COPS4 antibody (70R-3609) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COPS4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using COPS4 antibody (70R-3609) | COPS4 antibody (70R-3609) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors