CORIN antibody (70R-1759)

Rabbit polyclonal CORIN antibody raised against the C terminal of CORIN

Synonyms Polyclonal CORIN antibody, Anti-CORIN antibody, CRN antibody, MGC119742 antibody, ATC2 antibody, TMPRSS10 antibody, Lrp4 antibody, Corin Serine Peptidase antibody
Specificity CORIN antibody was raised against the C terminal of CORIN
Cross Reactivity Human
Applications WB
Immunogen CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG
Assay Information CORIN Blocking Peptide, catalog no. 33R-3817, is also available for use as a blocking control in assays to test for specificity of this CORIN antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CORIN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. CORIN converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors