Cornulin antibody (70R-4583)

Rabbit polyclonal Cornulin antibody raised against the middle region of CRNN

Synonyms Polyclonal Cornulin antibody, Anti-Cornulin antibody, PDRC1 antibody, CRNN antibody, SEP53 antibody, C1orf10 antibody
Specificity Cornulin antibody was raised against the middle region of CRNN
Cross Reactivity Human
Applications WB
Immunogen Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
Assay Information Cornulin Blocking Peptide, catalog no. 33R-3210, is also available for use as a blocking control in assays to test for specificity of this Cornulin antibody

Images

Western Blot analysis using Cornulin antibody (70R-4583)

Cornulin antibody (70R-4583) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRNN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cornulin antibody (70R-4583) | Cornulin antibody (70R-4583) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors