Cortactin antibody (70R-2725)

Rabbit polyclonal Cortactin antibody raised against the N terminal of CTTN

Synonyms Polyclonal Cortactin antibody, Anti-Cortactin antibody, EMS1 antibody, CTTN antibody, FLJ34459 antibody
Specificity Cortactin antibody was raised against the N terminal of CTTN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG
Assay Information Cortactin Blocking Peptide, catalog no. 33R-4411, is also available for use as a blocking control in assays to test for specificity of this Cortactin antibody


Western Blot analysis using Cortactin antibody (70R-2725)

Cortactin antibody (70R-2725) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTTN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cortactin antibody (70R-2725) | Cortactin antibody (70R-2725) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors