CPEB2 antibody (70R-1357)

Rabbit polyclonal CPEB2 antibody raised against the middle region of CPEB2

Synonyms Polyclonal CPEB2 antibody, Anti-CPEB2 antibody, Cytoplasmic Polyadenylation Element Binding Protein 2 antibody
Specificity CPEB2 antibody was raised against the middle region of CPEB2
Cross Reactivity Human,Mouse,Rat,Dog,Drosophila,ZebraFish
Applications WB
Immunogen CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL
Assay Information CPEB2 Blocking Peptide, catalog no. 33R-2191, is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody

Images

Western Blot analysis using CPEB2 antibody (70R-1357)

CPEB2 antibody (70R-1357) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CPEB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CPEB2 antibody (70R-1357) | CPEB2 antibody (70R-1357) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors