CPSF1 antibody (70R-4864)

Rabbit polyclonal CPSF1 antibody raised against the middle region of CPSF1

Synonyms Polyclonal CPSF1 antibody, Anti-CPSF1 antibody, Cleavage And Polyadenylation Specific Factor 1 160Kda antibody, P/cl.18 antibody, HSU37012 antibody, CPSF160 antibody
Specificity CPSF1 antibody was raised against the middle region of CPSF1
Cross Reactivity Human
Applications WB
Immunogen CPSF1 antibody was raised using the middle region of CPSF1 corresponding to a region with amino acids GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE
Assay Information CPSF1 Blocking Peptide, catalog no. 33R-3195, is also available for use as a blocking control in assays to test for specificity of this CPSF1 antibody

Images

Western Blot analysis using CPSF1 antibody (70R-4864)

CPSF1 antibody (70R-4864) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 161 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPSF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CPSF1 antibody (70R-4864) | CPSF1 antibody (70R-4864) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors