CPT1B antibody (70R-6487)

Rabbit polyclonal CPT1B antibody

Synonyms Polyclonal CPT1B antibody, Anti-CPT1B antibody, CPT 1, CPT1, CPT-1 antibody, M-CPT1 antibody, CPT 1 antibody, KIAA1670 antibody, CPT-1, Carnitine Palmitoyltransferase 1B antibody, CPT1-M antibody
Cross Reactivity Human
Applications WB
Immunogen CPT1B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Assay Information CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody


Western Blot analysis using CPT1B antibody (70R-6487)

CPT1B antibody (70R-6487) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPT1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CPT1B antibody (70R-6487) | CPT1B antibody (70R-6487) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors