CRAT antibody (70R-1945)

Rabbit polyclonal CRAT antibody raised against the N terminal of CRAT

Synonyms Polyclonal CRAT antibody, Anti-CRAT antibody, Carnitine Acetyltransferase antibody, CAT1 antibody, RP11-247A12.5 antibody
Specificity CRAT antibody was raised against the N terminal of CRAT
Cross Reactivity Human
Applications WB
Immunogen CRAT antibody was raised using the N terminal of CRAT corresponding to a region with amino acids MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD
Assay Information CRAT Blocking Peptide, catalog no. 33R-6123, is also available for use as a blocking control in assays to test for specificity of this CRAT antibody


Western Blot analysis using CRAT antibody (70R-1945)

CRAT antibody (70R-1945) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT geneuggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CRAT antibody (70R-1945) | CRAT antibody (70R-1945) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors