CRBN antibody (70R-3211)

Rabbit polyclonal CRBN antibody raised against the N terminal of CRBN

Synonyms Polyclonal CRBN antibody, Anti-CRBN antibody, DKFZp781K0715 antibody, Cereblon antibody, MRT2A antibody, MGC27358 antibody
Specificity CRBN antibody was raised against the N terminal of CRBN
Cross Reactivity Human
Applications WB
Immunogen CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
Assay Information CRBN Blocking Peptide, catalog no. 33R-2125, is also available for use as a blocking control in assays to test for specificity of this CRBN antibody

Images

Western Blot analysis using CRBN antibody (70R-3211)

CRBN antibody (70R-3211) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRBN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CRBN antibody (70R-3211) | CRBN antibody (70R-3211) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €352.82
Size: 50 ug
OR
Shipping
View Our Distributors