CREBBP antibody (70R-2027)

Rabbit polyclonal CREBBP antibody

Synonyms Polyclonal CREBBP antibody, Anti-CREBBP antibody, KAT3A antibody, RSTS antibody, Rubinstein-Taybi Syndrome antibody, Creb Binding Protein antibody, CBP antibody, RTS antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
Assay Information CREBBP Blocking Peptide, catalog no. 33R-9216, is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody


Western blot analysis using CREBBP antibody (70R-2027)

Recommended CREBBP Antibody Titration: 1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 261 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CREBBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using CREBBP antibody (70R-2027) | Recommended CREBBP Antibody Titration: 1 ug/ml
  • Immunohistochemical staining using CREBBP antibody (70R-2027) | Paraffin Embedded Tissue: Human Colon; Antibody Concentration: 5 ug/ml
  • Immunohistochemical staining using CREBBP antibody (70R-2027) | CREBBP antibody IHC staining of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors