CRLF1 Blocking Peptide (33R-10349)

A synthetic peptide for use as a blocking control in assays to test for specificity of CRLF1 antibody, catalog no. 70R-8187

Synonyms CRLF1 control peptide, CRLF1 antibody Blocking Peptide, Anti-CRLF1 Blocking Peptide, cytokine receptor-like factor 1 Blocking Peptide, CISS Blocking Peptide, CISS1 Blocking Peptide, CLF Blocking Peptide, CLF-1 Blocking Peptide, NR6 Blocking Peptide, zcytor5 Blocking Peptide, CRLF1, CRLF-1, CRLF 1, CRLF-1 Blocking Peptide, CRLF 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIP
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors