CRLF2 antibody (70R-4480)

Rabbit polyclonal CRLF2 antibody raised against the middle region of CRLF2

Synonyms Polyclonal CRLF2 antibody, Anti-CRLF2 antibody, TSLPR antibody, CRL2 antibody, Cytokine Receptor-Like Factor 2 antibody, CRLF2Y antibody
Specificity CRLF2 antibody was raised against the middle region of CRLF2
Cross Reactivity Human
Applications WB
Immunogen CRLF2 antibody was raised using the middle region of CRLF2 corresponding to a region with amino acids FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF
Assay Information CRLF2 Blocking Peptide, catalog no. 33R-3132, is also available for use as a blocking control in assays to test for specificity of this CRLF2 antibody


Western Blot analysis using CRLF2 antibody (70R-4480)

CRLF2 antibody (70R-4480) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRLF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CRLF2 antibody (70R-4480) | CRLF2 antibody (70R-4480) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors