CRMP1 Blocking Peptide (33R-8953)

A synthetic peptide for use as a blocking control in assays to test for specificity of CRMP1 antibody, catalog no. 70R-5252

Synonyms CRMP1 control peptide, CRMP1 antibody Blocking Peptide, Anti-CRMP1 Blocking Peptide, Collapsin Response Mediator Protein 1 Blocking Peptide, DPYSL1 Blocking Peptide, DRP-1 Blocking Peptide, DRP1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV
Molecular Weight 62 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors