CRMP1 Blocking Peptide (33R-8953)
A synthetic peptide for use as a blocking control in assays to test for specificity of CRMP1 antibody, catalog no. 70R-5252
Overview
Overview
| Synonyms | CRMP1 control peptide, CRMP1 antibody Blocking Peptide, Anti-CRMP1 Blocking Peptide, Collapsin Response Mediator Protein 1 Blocking Peptide, DPYSL1 Blocking Peptide, DRP-1 Blocking Peptide, DRP1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV |
|---|---|
| Molecular Weight | 62 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product