CRP antibody (70R-4527)

Rabbit polyclonal CRP antibody raised against the N terminal of CRP

Synonyms Polyclonal CRP antibody, Anti-CRP antibody, PTX1 antibody, C-Reactive Protein Pentraxin-Related antibody, MGC88244 antibody, MGC149895 antibody
Specificity CRP antibody was raised against the N terminal of CRP
Cross Reactivity Human
Applications WB
Immunogen CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
Assay Information CRP Blocking Peptide, catalog no. 33R-5929, is also available for use as a blocking control in assays to test for specificity of this CRP antibody


Western Blot analysis using CRP antibody (70R-4527)

CRP antibody (70R-4527) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CRP antibody (70R-4527) | CRP antibody (70R-4527) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors