CRP Blocking Peptide (33R-5929)
A synthetic peptide for use as a blocking control in assays to test for specificity of CRP antibody, catalog no. 70R-4527
Overview
Overview
| Synonyms | CRP control peptide, CRP antibody Blocking Peptide, Anti-CRP Blocking Peptide, C-Reactive Protein Pentraxin-Related Blocking Peptide, MGC149895 Blocking Peptide, MGC88244 Blocking Peptide, PTX1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA |
|---|---|
| Molecular Weight | 25 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product