CRP Blocking Peptide (33R-5929)

A synthetic peptide for use as a blocking control in assays to test for specificity of CRP antibody, catalog no. 70R-4527

Synonyms CRP control peptide, CRP antibody Blocking Peptide, Anti-CRP Blocking Peptide, C-Reactive Protein Pentraxin-Related Blocking Peptide, MGC149895 Blocking Peptide, MGC88244 Blocking Peptide, PTX1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
Molecular Weight 25 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors