Crystallin Beta A1 antibody (70R-2029)

Rabbit polyclonal Crystallin Beta A1 antibody raised against the N terminal of CRYBA1

Synonyms Polyclonal Crystallin Beta A1 antibody, Anti-Crystallin Beta A1 antibody, CRYBA1 antibody, CRYB1 antibody
Specificity Crystallin Beta A1 antibody was raised against the N terminal of CRYBA1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Crystallin Beta A1 antibody was raised using the N terminal of CRYBA1 corresponding to a region with amino acids METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS
Assay Information Crystallin Beta A1 Blocking Peptide, catalog no. 33R-5973, is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta A1 antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRYBA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families, Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors