CSGLCA-T Blocking Peptide (33R-8608)
A synthetic peptide for use as a blocking control in assays to test for specificity of CSGlcA-T antibody, catalog no. 70R-2825
Overview
Overview
| Synonyms | CSGLCA-T control peptide, CSGLCA-T antibody Blocking Peptide, Anti-CSGLCA-T Blocking Peptide, ChSy-3 Blocking Peptide, KIAA1402 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY |
|---|---|
| Molecular Weight | 18 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CSGlcA-T belongs to the chondroitin N-acetylgalactosaminyltransferase family. It transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. CSGlcA-T has no N-acetylgalactosaminyltransferase activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product