CSGLCA-T Blocking Peptide (33R-8608)

A synthetic peptide for use as a blocking control in assays to test for specificity of CSGlcA-T antibody, catalog no. 70R-2825

Synonyms CSGLCA-T control peptide, CSGLCA-T antibody Blocking Peptide, Anti-CSGLCA-T Blocking Peptide, ChSy-3 Blocking Peptide, KIAA1402 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY
Molecular Weight 18 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSGlcA-T belongs to the chondroitin N-acetylgalactosaminyltransferase family. It transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. CSGlcA-T has no N-acetylgalactosaminyltransferase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors