CSH1 Blocking Peptide (33R-8635)
A synthetic peptide for use as a blocking control in assays to test for specificity of CSH1 antibody, catalog no. 70R-1711
Overview
Overview
| Synonyms | CSH1 control peptide, CSH1 antibody Blocking Peptide, Anti-CSH1 Blocking Peptide, Chorionic Somatomammotropin Hormone 1 Blocking Peptide, Placental Lactogen Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS |
|---|---|
| Molecular Weight | 24 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product