CSH1 Blocking Peptide (33R-8635)

A synthetic peptide for use as a blocking control in assays to test for specificity of CSH1 antibody, catalog no. 70R-1711

Synonyms CSH1 control peptide, CSH1 antibody Blocking Peptide, Anti-CSH1 Blocking Peptide, Chorionic Somatomammotropin Hormone 1 Blocking Peptide, Placental Lactogen Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors