CSH2 Blocking Peptide (33R-4935)

A synthetic peptide for use as a blocking control in assays to test for specificity of CSH2 antibody, catalog no. 70R-4526

Synonyms CSH2 control peptide, CSH2 antibody Blocking Peptide, Anti-CSH2 Blocking Peptide, Chorionic Somatomammotropin Hormone 2 Blocking Peptide, CS-2 Blocking Peptide, CSB Blocking Peptide, hCS-B Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH
Molecular Weight 14 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors