Ctp Synthase antibody (70R-1217)

Rabbit polyclonal Ctp Synthase antibody raised against the C terminal of CTPS

Synonyms Polyclonal Ctp Synthase antibody, Anti-Ctp Synthase antibody, CTPS antibody
Specificity Ctp Synthase antibody was raised against the C terminal of CTPS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Ctp Synthase antibody was raised using the C terminal of CTPS corresponding to a region with amino acids FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH
Assay Information Ctp Synthase Blocking Peptide, catalog no. 33R-2906, is also available for use as a blocking control in assays to test for specificity of this Ctp Synthase antibody


Western Blot analysis using Ctp Synthase antibody (70R-1217)

Ctp Synthase antibody (70R-1217) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CTPS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Ctp Synthase antibody (70R-1217) | Ctp Synthase antibody (70R-1217) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors