CTSK Blocking Peptide (33R-8691)

A synthetic peptide for use as a blocking control in assays to test for specificity of CTSK antibody, catalog no. 70R-10206

Synonyms CTSK control peptide, CTSK antibody Blocking Peptide, Anti-CTSK Blocking Peptide, cathepsin K Blocking Peptide, CTS02 Blocking Peptide, CTSO Blocking Peptide, CTSO1 Blocking Peptide, CTSO2 Blocking Peptide, MGC23107 Blocking Peptide, PKND Blocking Peptide, PYCD Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors