CTSK Blocking Peptide (33R-8691)
A synthetic peptide for use as a blocking control in assays to test for specificity of CTSK antibody, catalog no. 70R-10206
Overview
Overview
| Synonyms | CTSK control peptide, CTSK antibody Blocking Peptide, Anti-CTSK Blocking Peptide, cathepsin K Blocking Peptide, CTS02 Blocking Peptide, CTSO Blocking Peptide, CTSO1 Blocking Peptide, CTSO2 Blocking Peptide, MGC23107 Blocking Peptide, PKND Blocking Peptide, PYCD Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product