CUGBP1 Blocking Peptide (33R-1032)
A synthetic peptide for use as a blocking control in assays to test for specificity of CUGBP1 antibody, catalog no. 70R-4862
Overview
Overview
| Synonyms | CUGBP1 control peptide, CUGBP1 antibody Blocking Peptide, Anti-CUGBP1 Blocking Peptide, Cug Triplet Repeat Rna Binding Protein 1 Blocking Peptide, BRUNOL2 Blocking Peptide, CUG-BP Blocking Peptide, CUGBP Blocking Peptide, NAB50 Blocking Peptide, hNab50 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT |
|---|---|
| Molecular Weight | 56 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product