CUGBP1 Blocking Peptide (33R-1032)

A synthetic peptide for use as a blocking control in assays to test for specificity of CUGBP1 antibody, catalog no. 70R-4862

Synonyms CUGBP1 control peptide, CUGBP1 antibody Blocking Peptide, Anti-CUGBP1 Blocking Peptide, Cug Triplet Repeat Rna Binding Protein 1 Blocking Peptide, BRUNOL2 Blocking Peptide, CUG-BP Blocking Peptide, CUGBP Blocking Peptide, NAB50 Blocking Peptide, hNab50 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors