CUGBP2 antibody (70R-4819)

Rabbit polyclonal CUGBP2 antibody raised against the N terminal of CUGBP2

Synonyms Polyclonal CUGBP2 antibody, Anti-CUGBP2 antibody, ETR-3 antibody, NAPOR antibody, Cug Triplet Repeat Rna Binding Protein 2 antibody, BRUNOL3 antibody
Specificity CUGBP2 antibody was raised against the N terminal of CUGBP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids NIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSP
Assay Information CUGBP2 Blocking Peptide, catalog no. 33R-6723, is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody


Western Blot analysis using CUGBP2 antibody (70R-4819)

CUGBP2 antibody (70R-4819) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CUGBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CUGBP2 antibody (70R-4819) | CUGBP2 antibody (70R-4819) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors