CUGBP2 antibody (70R-4886)

Rabbit polyclonal CUGBP2 antibody raised against the N terminal of CUGBP2

Synonyms Polyclonal CUGBP2 antibody, Anti-CUGBP2 antibody, ETR-3 antibody, Cug Triplet Repeat Rna Binding Protein 2 antibody, NAPOR antibody, BRUNOL3 antibody
Specificity CUGBP2 antibody was raised against the N terminal of CUGBP2
Cross Reactivity Human
Applications WB
Immunogen CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV
Assay Information CUGBP2 Blocking Peptide, catalog no. 33R-9274, is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Images

Western Blot analysis using CUGBP2 antibody (70R-4886)

CUGBP2 antibody (70R-4886) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CUGBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CUGBP2 antibody (70R-4886) | CUGBP2 antibody (70R-4886) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors