CUTC antibody (70R-3761)

Rabbit polyclonal CUTC antibody

Synonyms Polyclonal CUTC antibody, Anti-CUTC antibody, RP11-483F11.3 antibody, CGI-32 antibody, Cutc Copper Transporter Homolog antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMA
Assay Information CUTC Blocking Peptide, catalog no. 33R-4548, is also available for use as a blocking control in assays to test for specificity of this CUTC antibody


Western Blot analysis using CUTC antibody (70R-3761)

CUTC antibody (70R-3761) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CUTC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CUTC antibody (70R-3761) | CUTC antibody (70R-3761) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors