CXCL1 Blocking Peptide (33R-7741)

A synthetic peptide for use as a blocking control in assays to test for specificity of CXCL1 antibody, catalog no. 70R-10502

Synonyms CXCL1 control peptide, CXCL1 antibody Blocking Peptide, Anti-CXCL1 Blocking Peptide, chemokine, C-X-C motif ligand 1, melanoma growth stimulating activity, alpha Blocking Peptide, GRO1 Blocking Peptide, GROa Blocking Peptide, MGSA Blocking Peptide, MGSA alpha Blocking Peptide, MGSA-a Blocking Peptide, NAP-3 Blocking Peptide, SCYB1 Blocking Peptide, CXCL1, CXCL-1, CXCL 1, CXCL-1 Blocking Peptide, CXCL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Molecular Weight 8 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors