CXCL1 Blocking Peptide (33R-7741)
A synthetic peptide for use as a blocking control in assays to test for specificity of CXCL1 antibody, catalog no. 70R-10502
Overview
Overview
| Synonyms | CXCL1 control peptide, CXCL1 antibody Blocking Peptide, Anti-CXCL1 Blocking Peptide, chemokine, C-X-C motif ligand 1, melanoma growth stimulating activity, alpha Blocking Peptide, GRO1 Blocking Peptide, GROa Blocking Peptide, MGSA Blocking Peptide, MGSA alpha Blocking Peptide, MGSA-a Blocking Peptide, NAP-3 Blocking Peptide, SCYB1 Blocking Peptide, CXCL1, CXCL-1, CXCL 1, CXCL-1 Blocking Peptide, CXCL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
|---|---|
| Molecular Weight | 8 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product