CXCL2 protein (Mouse) (His tag) (80R-3349)
Purified recombinant CXCL2 protein (Mouse) (His tag)
Overview
Overview
| Synonyms | Macrophage inflammatory 2 protein, MIP2 protein, C X C motif chemokine 2 protein, CXCL 2 protein, CXCL-2 protein |
|---|---|
| Species | Mouse |
| Protein Type | Recombinant |
| Applications | ELISA, SDS-PAGE, WB |
Specifications
| Residues | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
|---|---|
| Expression System | E.coli |
| Source | His-fusion expressed as an inclusion body |
| Grade & Purity | > 90% pure |
| Molecular Weight | 15 kDa |
| Tag/Conjugate | His tag |
| Form & Buffer | Supplied in liquid form in 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin (pH 8.0) and 200 mM Imidazole |
Storage & Safety
| Storage | Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles |
|---|
General Information
| Biological Significance | CXCL2 is chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product