CXCL2 protein (Mouse) (His tag) (80R-3349)

Purified recombinant CXCL2 protein (Mouse) (His tag)

Synonyms Macrophage inflammatory 2 protein, MIP2 protein, C X C motif chemokine 2 protein, CXCL 2 protein, CXCL-2 protein
Species Mouse
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

SDS-PAGE analysis of CXCL2 protein (Mouse) (His tag) (80R-3349)

Specifications

Residues AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Expression System E.coli
Source His-fusion expressed as an inclusion body
Grade & Purity > 90% pure
Molecular Weight 15 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin (pH 8.0) and 200 mM Imidazole

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance CXCL2 is chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • SDS-PAGE analysis of CXCL2 protein (Mouse) (His tag) (80R-3349)

Availability: In stock

Price: €182.41
Size: 50 ug
OR
Shipping
View Our Distributors