CXORF9 antibody (70R-4377)

Rabbit polyclonal CXORF9 antibody raised against the N terminal Of Cxorf9

Synonyms Polyclonal CXORF9 antibody, Anti-CXORF9 antibody, SLY antibody, 753P9 antibody, Chromosome X Open Reading Frame 9 antibody
Specificity CXORF9 antibody was raised against the N terminal Of Cxorf9
Cross Reactivity Human
Applications WB
Immunogen CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM
Assay Information CXORF9 Blocking Peptide, catalog no. 33R-4594, is also available for use as a blocking control in assays to test for specificity of this CXORF9 antibody

Images

Western Blot analysis using CXORF9 antibody (70R-4377)

CXORF9 antibody (70R-4377) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXORF9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The CXORF9 protein contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CXORF9 antibody (70R-4377) | CXORF9 antibody (70R-4377) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors