CXorf9 Blocking Peptide (33R-8108)
A synthetic peptide for use as a blocking control in assays to test for specificity of CXorf9 antibody, catalog no. 70R-9494
Overview
Overview
| Synonyms | CXorf9 control peptide, CXorf9 antibody Blocking Peptide, Anti-CXorf9 Blocking Peptide, SAM and SH3 domain containing 3 Blocking Peptide, 753P9 Blocking Peptide, CXorf9 Blocking Peptide, HACS2 Blocking Peptide, SH3D6C Blocking Peptide, SLY Blocking Peptide, CXorf9, CXorf-9, CXorf 9, CXorf-9 Blocking Peptide, CXorf 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of this protein remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product