Cyclin B1 antibody (70R-5593)

Rabbit polyclonal Cyclin B1 antibody raised against the middle region of CCNB1

Synonyms Polyclonal Cyclin B1 antibody, Anti-Cyclin B1 antibody, Cyclin B-1 antibody, G2/mitotic-specific cyclin-B1 antibody, Cyclin B1, Cyclin B 1, CCNB antibody, Cyclin B 1 antibody, CCNB1 antibody, Cyclin B-1
Specificity Cyclin B1 antibody was raised against the middle region of CCNB1
Cross Reactivity Human
Applications WB
Immunogen Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Assay Information Cyclin B1 Blocking Peptide, catalog no. 33R-1305, is also available for use as a blocking control in assays to test for specificity of this Cyclin B1 antibody

Images

Western Blot analysis using Cyclin B1 antibody (70R-5593)

Cyclin B1 antibody (70R-5593) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCNB1 is a regulatory protein involved in mitosis. CCNB1 complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cyclin B1 antibody (70R-5593) | Cyclin B1 antibody (70R-5593) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors