CYCS Blocking Peptide (33R-10342)

A synthetic peptide for use as a blocking control in assays to test for specificity of CYCS antibody, catalog no. 70R-10215

Synonyms CYCS control peptide, CYCS antibody Blocking Peptide, Anti-CYCS Blocking Peptide, cytochrome c, somatic Blocking Peptide, CYC Blocking Peptide, HCS Blocking Peptide, THC4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues IFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGII
Molecular Weight 12 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors