CYP2A13 antibody (70R-1870)
Rabbit polyclonal CYP2A13 antibody raised against the C terminal of CYP2A13
Overview
Overview
Synonyms | Polyclonal CYP2A13 antibody, Anti-CYP2A13 antibody, Cytochrome P450 Family 2 Subfamily A Polypeptide 13 antibody, CYPA13-2, CPAD antibody, CYPA13 2, CYP2A13, CYP2A antibody, CYPA13 2 antibody, CYPA13-2 antibody |
---|---|
Specificity | CYP2A13 antibody was raised against the C terminal of CYP2A13 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF |
Assay Information | CYP2A13 Blocking Peptide, catalog no. 33R-2112, is also available for use as a blocking control in assays to test for specificity of this CYP2A13 antibody |
Images
Western Blot analysis using CYP2A13 antibody (70R-1870)
CYP2A13 antibody (70R-1870) used at 5 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Total IgG Protein A purified |
Molecular Weight | 54 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CYP2A13 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 5 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product