CYP2A13 antibody (70R-1870)

Rabbit polyclonal CYP2A13 antibody raised against the C terminal of CYP2A13

Synonyms Polyclonal CYP2A13 antibody, Anti-CYP2A13 antibody, Cytochrome P450 Family 2 Subfamily A Polypeptide 13 antibody, CYPA13-2, CPAD antibody, CYPA13 2, CYP2A13, CYP2A antibody, CYPA13 2 antibody, CYPA13-2 antibody
Specificity CYP2A13 antibody was raised against the C terminal of CYP2A13
Cross Reactivity Human
Applications WB
Immunogen CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
Assay Information CYP2A13 Blocking Peptide, catalog no. 33R-2112, is also available for use as a blocking control in assays to test for specificity of this CYP2A13 antibody

Images

Western Blot analysis using CYP2A13 antibody (70R-1870)

CYP2A13 antibody (70R-1870) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CYP2A13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP2A13 antibody (70R-1870) | CYP2A13 antibody (70R-1870) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors