CYP2D6 antibody (70R-1868)

Rabbit polyclonal CYP2D6 antibody raised against the N terminal of CYP2D6

Synonyms Polyclonal CYP2D6 antibody, Anti-CYP2D6 antibody, CYPD6-2 antibody, MGC120389 antibody, CYP2D antibody, MGC120390 antibody, CYPD6 2 antibody, Cytochrome P450 Family 2 Subfamily D Polypeptide 6 antibody, CYP2D antibody, CYPD6-2, CYP2D6, P450-DB1 antibody, CYP2DL1 antibody, RP4-669P10.2 antibody, CPD6 antibody, P450C2D antibody, CYPD6 2
Specificity CYP2D6 antibody was raised against the N terminal of CYP2D6
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen CYP2D6 antibody was raised using the N terminal of CYP2D6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Assay Information CYP2D6 Blocking Peptide, catalog no. 33R-8102, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody


Immunohistochemical staining using CYP2D6 antibody (70R-1868)

CYP2D6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CYP2D6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CYP2D6 antibody (70R-1868) | CYP2D6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using CYP2D6 antibody (70R-1868) | CYP2D6 antibody (70R-1868) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors