CYP3A7 antibody (70R-1867)

Rabbit polyclonal CYP3A7 antibody raised against the middle region of CYP3A7

Synonyms Polyclonal CYP3A7 antibody, Anti-CYP3A7 antibody, CYPA7 3 antibody, CP37 antibody, CYPA7-3 antibody, CYP3A7, CYPA7 3, Cytochrome P450 Family 3 Subfamily A Polypeptide 7 antibody, P450-HFLA antibody, CYPA7-3
Specificity CYP3A7 antibody was raised against the middle region of CYP3A7
Cross Reactivity Human
Applications WB
Immunogen CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
Assay Information CYP3A7 Blocking Peptide, catalog no. 33R-4668, is also available for use as a blocking control in assays to test for specificity of this CYP3A7 antibody


Western Blot analysis using CYP3A7 antibody (70R-1867)

CYP3A7 antibody (70R-1867) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CYP3A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CYP3A7 antibody (70R-1867) | CYP3A7 antibody (70R-1867) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors