Cystathionase antibody (70R-1982)

Rabbit polyclonal Cystathionase antibody

Synonyms Polyclonal Cystathionase antibody, Anti-Cystathionase antibody, MGC9471 antibody, Cystathionine Gamma-Lyase antibody, CTH antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF
Assay Information Cystathionase Blocking Peptide, catalog no. 33R-9734, is also available for use as a blocking control in assays to test for specificity of this Cystathionase antibody


Western Blot analysis using Cystathionase antibody (70R-1982)

Cystathionase antibody (70R-1982) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cystathionase antibody (70R-1982) | Cystathionase antibody (70R-1982) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors