Cystatin B antibody (70R-2262)

Rabbit polyclonal Cystatin B antibody

Synonyms Polyclonal Cystatin B antibody, Anti-Cystatin B antibody, PME antibody, CST6 antibody, Stefin B antibody, CSTB antibody, EPM1 antibody, STFB antibody
Cross Reactivity Human
Applications WB
Immunogen Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG
Assay Information Cystatin B Blocking Peptide, catalog no. 33R-6226, is also available for use as a blocking control in assays to test for specificity of this Cystatin B antibody


Immunohistochemical staining using Cystatin B antibody (70R-2262)

Cystatin B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSTB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Cystatin B antibody (70R-2262) | Cystatin B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Cystatin B antibody (70R-2262) | Cystatin B antibody (70R-2262) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors