Cytokeratin 13 antibody (70R-2265)

Rabbit polyclonal Cytokeratin 13 antibody raised against the N terminal of KRT13

Synonyms Polyclonal Cytokeratin 13 antibody, Anti-Cytokeratin 13 antibody, Cytokeratin 13, Cytokeratin -13 antibody, MGC161462 antibody, CK13 antibody, Cytokeratin 13, KRT13 antibody, K13 antibody, Cytokeratin -13, Keratin 13 antibody, Cytokeratin 13 antibody, MGC3781 antibody
Specificity Cytokeratin 13 antibody was raised against the N terminal of KRT13
Cross Reactivity Human
Applications WB
Immunogen Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY
Assay Information Cytokeratin 13 Blocking Peptide, catalog no. 33R-9208, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Images

Western Blot analysis using Cytokeratin 13 antibody (70R-2265)

Cytokeratin 13 antibody (70R-2265) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRT13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cytokeratin 13 antibody (70R-2265) | Cytokeratin 13 antibody (70R-2265) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors