DAAM1 antibody (70R-2236)

Rabbit polyclonal DAAM1 antibody raised against the middle region of DAAM1

Synonyms Polyclonal DAAM1 antibody, Anti-DAAM1 antibody, DAAM1, KIAA0666 antibody, DAAM-1, DAAM 1 antibody, DAAM 1, Dishevelled Associated Activator Of Morphogenesis 1 antibody, FLJ41657 antibody, DAAM-1 antibody
Specificity DAAM1 antibody was raised against the middle region of DAAM1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV
Assay Information DAAM1 Blocking Peptide, catalog no. 33R-3460, is also available for use as a blocking control in assays to test for specificity of this DAAM1 antibody


Western Blot analysis using DAAM1 antibody (70R-2236)

DAAM1 antibody (70R-2236) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 123 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAAM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DAAM1 antibody (70R-2236) | DAAM1 antibody (70R-2236) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors