DAK antibody (70R-2702)

Rabbit polyclonal DAK antibody

Synonyms Polyclonal DAK antibody, Anti-DAK antibody, DKFZP586B1621 antibody, MGC5621 antibody, Dihydroxyacetone Kinase 2 Homolog antibody
Cross Reactivity Human, Mouse
Applications WB
Immunogen DAK antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA
Assay Information DAK Blocking Peptide, catalog no. 33R-6563, is also available for use as a blocking control in assays to test for specificity of this DAK antibody

Images

Western Blot analysis using DAK antibody (70R-2702)

DAK antibody (70R-2702) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DAK antibody (70R-2702) | DAK antibody (70R-2702) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors