DAP3 Blocking Peptide (33R-10326)

A synthetic peptide for use as a blocking control in assays to test for specificity of DAP3 antibody, catalog no. 70R-10345

Synonyms DAP3 control peptide, DAP3 antibody Blocking Peptide, Anti-DAP3 Blocking Peptide, death associated protein 3 Blocking Peptide, DAP-3 Blocking Peptide, DKFZp686G12159 Blocking Peptide, MGC126058 Blocking Peptide, MGC126059 Blocking Peptide, MRP-S29 Blocking Peptide, MRPS29 Blocking Peptide, bMRP-10 Blocking Peptide, DAP3, DAP-3, DAP 3, DAP-3 Blocking Peptide, DAP 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues FIPILVSNYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPS
Molecular Weight 44 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. This gene encodes a 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors