DAZAP1 antibody (70R-1355)

Rabbit polyclonal DAZAP1 antibody raised against the C terminal of DAZAP1

Synonyms Polyclonal DAZAP1 antibody, Anti-DAZAP1 antibody, Daz Associated Protein 1 antibody
Specificity DAZAP1 antibody was raised against the C terminal of DAZAP1
Cross Reactivity Human
Applications IHC, WB
Immunogen DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP
Assay Information DAZAP1 Blocking Peptide, catalog no. 33R-4764, is also available for use as a blocking control in assays to test for specificity of this DAZAP1 antibody

Images

Immunohistochemical staining using DAZAP1 antibody (70R-1355)

DAZAP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DAZAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DAZAP1 antibody (70R-1355) | DAZAP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.
  • Western Blot analysis using DAZAP1 antibody (70R-1355) | DAZAP1 antibody (70R-1355) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using DAZAP1 antibody (70R-1355) | DAZAP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors