DBNL antibody (70R-2474)

Rabbit polyclonal DBNL antibody raised against the middle region of DBNL

Synonyms Polyclonal DBNL antibody, Anti-DBNL antibody, SH3P7 antibody, HIP-55 antibody, Drebrin-Like antibody, ABP1 antibody
Specificity DBNL antibody was raised against the middle region of DBNL
Cross Reactivity Human
Applications WB
Immunogen DBNL antibody was raised using the middle region of DBNL corresponding to a region with amino acids QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
Assay Information DBNL Blocking Peptide, catalog no. 33R-7539, is also available for use as a blocking control in assays to test for specificity of this DBNL antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DBNL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors