DBT antibody (70R-2499)

Rabbit polyclonal DBT antibody raised against the N terminal of DBT

Synonyms Polyclonal DBT antibody, Anti-DBT antibody, Dihydrolipoamide Branched Chain Transacylase E2 antibody, BCATE2 antibody, E2B antibody, E2 antibody, MGC9061 antibody
Specificity DBT antibody was raised against the N terminal of DBT
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW
Assay Information DBT Blocking Peptide, catalog no. 33R-6946, is also available for use as a blocking control in assays to test for specificity of this DBT antibody


Immunohistochemical staining using DBT antibody (70R-2499)

DBT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DBT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DBT antibody (70R-2499) | DBT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using DBT antibody (70R-2499) | DBT antibody (70R-2499) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using DBT antibody (70R-2499) | DBT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors